Structure of PDB 7toq Chain AS15

Receptor sequence
>7toqAS15 (length=120) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
FRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLSRGLRRKQHSLLKRLR
KAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEM
IGHYLGEFSITYKPVKHGRP
3D structure
PDB7toq Ribosome inhibition by C9ORF72-ALS/FTD-associated poly-PR and poly-GR proteins revealed by cryo-EM.
ChainAS15
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS15 S38 A39 R40 R42 R43 R44 R47 R50 R51 K52 R59 K77 H79 R81 D82 Y97 G99 K100 F102 Y115 G117 E118 T122 K124 V126 H128 R130 S27 A28 R29 R31 R32 R33 R36 R39 R40 K41 R48 K66 H68 R70 D71 Y86 G88 K89 F91 Y104 G106 E107 T111 K113 V115 H117 R119
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7toq, PDBe:7toq, PDBj:7toq
PDBsum7toq
PubMed35589706
UniProtG1U0Q2|RS15_RABIT Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]