Structure of PDB 4xej Chain AS12

Receptor sequence

>4xejAS12 (length=122) Species: 262724 (Thermus thermophilus HB27)

PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRK
VAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGV
YDAAGVKDRKKSRSKYGTKKPK

3D structure

• PDB: 4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
• Chain: AS12
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS12	P4 T5 N7 Q8 L9 R11 R14 E15 R18 K19 K22 K27 G28 P30 F31 R32 R33 N48 S49 A50 L51 R52 K53 T60 Y68 P70 G71 R85 G86 K90 D91 V103 Y104 R112 K113 K114 S115 R116 S117 K118 Y119 G120 T121 K122 K123	P1 T2 N4 Q5 L6 R8 R11 E12 R15 K16 K19 K24 G25 P27 F28 R29 R30 N45 S46 A47 L48 R49 K50 T57 Y65 P67 G68 R82 G83 K87 D88 V100 Y101 R109 K110 K111 S112 R113 S114 K115 Y116 G117 T118 K119 K120

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4xej, PDBe:4xej, PDBj:4xej
• PDBsum: 4xej
• PubMed: 25652826
• UniProt: P61941|RS12_THET2 Small ribosomal subunit protein uS12 (Gene Name=rpsL)