Structure of PDB 9bdn Chain AS05

Receptor sequence
>9bdnAS05 (length=185) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
TPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRK
AQCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLV
NAIINSGPREDSTRIRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTI
AECLADELINAAKGSSNSYAIKKKDELERVAKSNR
3D structure
PDB9bdn Structural mechanism of angiogenin activation by the ribosome.
ChainAS05
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS05 H51 A57 K59 R60 K63 R71 N74 M76 M78 H79 G80 R81 N82 G84 K85 K86 M88 N148 W152 R159 F163 R164 N165 I166 T168 I169 H38 A44 K46 R47 K50 R58 N61 M63 M65 H66 G67 R68 N69 G71 K72 K73 M75 N129 W133 R140 F144 R145 N146 I147 T149 I150
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9bdn, PDBe:9bdn, PDBj:9bdn
PDBsum9bdn
PubMed38718836
UniProtG1TFM5|RS5_RABIT Small ribosomal subunit protein uS7 (Gene Name=RPS5)

[Back to BioLiP]