Structure of PDB 4xej Chain AS04

Receptor sequence

>4xejAS04 (length=208) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

PDB

4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.

Chain

AS04

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS04	G2 R3 I5 P7 V8 C9 R10 R13 R14 K22 G23 R25 R35 R36 Y38 P40 G41 Q42 H43 Q45 S52 R59 Q62 R65 E72 R73 Q74 N77 K85 K86 V112 S113 R115 Q116 R118 Q119 R122 H123 H125 R132 V133 L135 P136 Y138 S208 R209	G1 R2 I4 P6 V7 C8 R9 R12 R13 K21 G22 R24 R34 R35 Y37 P39 G40 Q41 H42 Q44 S51 R58 Q61 R64 E71 R72 Q73 N76 K84 K85 V111 S112 R114 Q115 R117 Q118 R121 H122 H124 R131 V132 L134 P135 Y137 S207 R208
BS02	ZN	AS04	K22 C31	K21 C30

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4xej, PDBe:4xej, PDBj:4xej
PDBsum	4xej
PubMed	25652826
UniProt	P62664\|RS4_THET2 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]