Structure of PDB 8uej Chain AS |
>8uejAS (length=122) Species: 767473 (Caulobacter phage phiCb5) [Search protein sequence] |
ALGDTLTITLGGSGGTAKVLRKINQDGYTSEYYLPETSSSFRAKVRHTKE SVKPNQVQYERHNVEFTETVYASGSTPEFVRQAYVVIRHKVGDVSATVSD LGEALSFYLNEALYGKLIGWES |
|
PDB | 8uej Structural mechanisms of Tad pilus assembly and its interaction with an RNA virus. |
Chain | AS |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
AS |
Q25 D26 |
Q25 D26 |
|
|
|
|