Structure of PDB 8evr Chain AS

Receptor sequence

>8evrAS (length=172) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHK
VKKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRV
AAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKF
PLPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

8evr Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	M1 A2 N62 N65 E66 H68 K71 S83 R84 S85 H88 M90 Y91 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 L144 K146 H154 R155 K158 S159 Y165 S169 T170 F171	M1 A2 N62 N65 E66 H68 K71 S83 R84 S85 H88 M90 Y91 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 L144 K146 H154 R155 K158 S159 Y165 S169 T170 F171
BS02	rna	AS	R13 S39 R40 Y43 Q46 H49 K50 V51 K52 K53 R119	R13 S39 R40 Y43 Q46 H49 K50 V51 K52 K53 R119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8evr, PDBe:8evr, PDBj:8evr
PDBsum	8evr
PubMed	37595043
UniProt	B3LMD0

[Back to BioLiP]