Structure of PDB 8eub Chain AS

Receptor sequence

>8eubAS (length=172) Species: 4932 (Saccharomyces cerevisiae)

MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHK
VKKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRV
AAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKF
PLPHRVQKSTKTFSYKRPSTFY

3D structure

• PDB: 8eub Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: AS
• Resolution: 2.52 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	M1 A2 N62 N65 E66 H68 P69 K71 S83 R84 S85 H88 N89 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 L144 T145 K146 P153 H154 R155 Q157 S159 K161 Y165 K166 S169 T170 F171	M1 A2 N62 N65 E66 H68 P69 K71 S83 R84 S85 H88 N89 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 L144 T145 K146 P153 H154 R155 Q157 S159 K161 Y165 K166 S169 T170 F171
BS02	rna	AS	R13 S39 R40 Y43 Q46 H49 K50 V51 K52 K53 R84 R119	R13 S39 R40 Y43 Q46 H49 K50 V51 K52 K53 R84 R119

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8eub, PDBe:8eub, PDBj:8eub
• PDBsum: 8eub
• PubMed: 37595043
• UniProt: B3LMD0