Structure of PDB 7og4 Chain AS |
>7og4AS (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] |
AGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPPLREPVFQRPRV RYGKAKAPIQDIWYHEDRIRAKFYSVYGSGQRAFDLFNPNFKSTCQRFVE KYTELQKLGETDEEKLFVETGKALLAEGVILRR |
|
PDB | 7og4 Structural basis of mitochondrial translation. |
Chain | AS |
Resolution | 3.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
AS |
Y53 K55 |
Y52 K54 |
|
|
|
|