Structure of PDB 6xir Chain AS

Receptor sequence

>6xirAS (length=63) Species: 4932 (Saccharomyces cerevisiae)

TPVTLAKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDIL
VLMESEREARRLR

3D structure

• PDB: 6xir Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.
• Chain: AS
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	R18 S21 R22 G23 G24 V25	R14 S17 R18 G19 G20 V21

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri May 9 19:42:17 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1472         else:

=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1474     

   1475     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6xir', asym_id = 'AS', title = 'Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6xir', asym_id='AS', title='Structural impact of K63 ubiquitin on yeast translocating ribosomes under oxidative stress.')

    840 

    841     if go:

=>  842         display_go(go,uniprot,pdbid,asym_id)

    843     return pubmed,uniprot

    844 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '6xir', asym_id = 'AS'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='6xir', asym_id='AS')

    481         '''.replace("$namespace_link",namespace_link

    482           ).replace("$namespace",namespace

=>  483           ).replace("$uniprot",u

    484         ))

    485         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>