Structure of PDB 6eri Chain AS

Receptor sequence

>6eriAS (length=171) Species: 3562 (Spinacia oleracea) [Search protein sequence]

EPGKCDEITTRGYSISMSVDKARRVIDQIRGRSYAETLMILELMPYRACY
PIFKLIYSAAANASHNKQFNKANLIISKAEVNKGITLKKVKPRARGRSYM
IKRPTCHITIVLRDITHFDSYDKFLESLTPKKLIALLGLMSTGRRRELLC
GRFRENHKIKSFLYKIALFKR

3D structure

PDB

6eri Structure of the chloroplast ribosome with chl-RRF and hibernation-promoting factor.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	R35 Y37 S38 S42 K45 R47 R48 R71 K78 Y81 S82 A85 N86 H89 N90 N106 K107 I109 K112 K113 K115 P116 R117 A118 G120 R121 Y123 I125 K126 R127 S185 R195	R11 Y13 S14 S18 K21 R23 R24 R47 K54 Y57 S58 A61 N62 H65 N66 N82 K83 I85 K88 K89 K91 P92 R93 A94 G96 R97 Y99 I101 K102 R103 S161 R171

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6eri, PDBe:6eri, PDBj:6eri
PDBsum	6eri
PubMed	29610536
UniProt	P09594\|RK22_SPIOL Large ribosomal subunit protein uL22c (Gene Name=rpl22)

[Back to BioLiP]