Structure of PDB 5jc9 Chain AS

Receptor sequence
>5jc9AS (length=79) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR
3D structure
PDB5jc9 Resistance mutations generate divergent antibiotic susceptibility profiles against translation inhibitors.
ChainAS
Resolution3.03 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS R3 S4 L5 K6 F10 H14 K17 K18 W34 R36 R37 G54 R55 K70 G72 T77 R78 T79 Y80 R1 S2 L3 K4 F8 H12 K15 K16 W32 R34 R35 G52 R53 K68 G70 T75 R76 T77 Y78
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jc9, PDBe:5jc9, PDBj:5jc9
PDBsum5jc9
PubMed27382179
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]