Structure of PDB 4ybb Chain AS

Receptor sequence

>4ybbAS (length=79) Species: 83333 (Escherichia coli K-12)

RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR

3D structure

• PDB: 4ybb High-resolution structure of the Escherichia coli ribosome.
• Chain: AS
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	R3 L5 K6 K7 F10 H14 K18 W34 R36 R37 H52 G54 R55 K70 G72 E73 T77 R78 T79 Y80 R81	R1 L3 K4 K5 F8 H12 K16 W32 R34 R35 H50 G52 R53 K68 G70 E71 T75 R76 T77 Y78 R79

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit

External links

• PDB: RCSB:4ybb, PDBe:4ybb, PDBj:4ybb
• PDBsum: 4ybb
• PubMed: 25775265
• UniProt: P0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)