Structure of PDB 4v9j Chain AS

Receptor sequence
>4v9jAS (length=79) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
SLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYN
GKQHVPVYITENMVGHKLGEFAPTRTYRG
3D structure
PDB4v9j Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainAS
Resolution3.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS S4 L5 K6 F10 K18 W34 S35 R36 R37 Y52 G54 K55 K70 G72 E73 T77 R78 T79 R81 S1 L2 K3 F7 K15 W31 S32 R33 R34 Y49 G51 K52 K67 G69 E70 T74 R75 T76 R78
BS02 rna AS K28 R29 K25 R26
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9j, PDBe:4v9j, PDBj:4v9j
PDBsum4v9j
PubMed23812722
UniProtP62660|RS19_THET2 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]