Structure of PDB 4v7t Chain AS

Receptor sequence

>4v7tAS (length=79) Species: 83333 (Escherichia coli K-12)

RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR

3D structure

• PDB: 4v7t Structures of the Escherichia coli ribosome with antibiotics bound near the peptidyl transferase center explain spectra of drug action.
• Chain: AS
• Resolution: 3.1942 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	R2 S3 L4 K5 F9 H13 K17 W33 R35 R36 G53 R54 K69 G71 E72 T76 R77 T78 R80	R1 S2 L3 K4 F8 H12 K16 W32 R34 R35 G52 R53 K68 G70 E71 T75 R76 T77 R79

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit

External links

• PDB: RCSB:4v7t, PDBe:4v7t, PDBj:4v7t
• PDBsum: 4v7t
• PubMed: 20876128
• UniProt: P0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)