Structure of PDB 4v7h Chain AS

Receptor sequence
>4v7hAS (length=71) Species: 5541 (Thermomyces lanuginosus) [Search protein sequence]
RGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGI
YNGKAFNQVEIRPEMLGHYLG
3D structure
PDB4v7h Comprehensive molecular structure of the eukaryotic ribosome.
ChainAS
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS R47 T50 S51 K58 K59 R61 A62 K64 R77 T78 H79 M80 R81 N82 I96 Y97 G99 K100 Y115 L116 R1 T4 S5 K12 K13 R15 A16 K18 R31 T32 H33 M34 R35 N36 I50 Y51 G53 K54 Y69 L70
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Nov 26 18:41:03 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7h', asym_id = 'AS', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7h', asym_id='AS', title='Comprehensive molecular structure of the eukaryotic ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v7h', asym_id = 'AS'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v7h', asym_id='AS')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>