Structure of PDB 4v71 Chain AS

Receptor sequence
>4v71AS (length=79) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVH
NGRQHVPVFVTDEMVGHKLGEFAPTRTYR
3D structure
PDB4v71 Energy barriers and driving forces in tRNA translocation through the ribosome.
ChainAS
Resolution20.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AS R2 S3 L4 K5 K16 K17 K20 T32 W33 S34 R35 R36 H51 G53 R54 K69 G71 E72 R77 T78 Y79 R80 R1 S2 L3 K4 K15 K16 K19 T31 W32 S33 R34 R35 H50 G52 R53 K68 G70 E71 R76 T77 Y78 R79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v71, PDBe:4v71, PDBj:4v71
PDBsum4v71
PubMed24186064
UniProtP0A7U3|RS19_ECOLI Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]