Structure of PDB 4v6u Chain AS

Receptor sequence
>4v6uAS (length=67) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
MGKIRQGFIKRVARELVNKYPNEFTTDFEHNKKKVQELTNVTSKKIRNRI
AGYVTKLVRMKMEGKIL
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainAS
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS M1 G2 K3 I4 R5 Q6 F28 K32 S43 K44 I46 N48 R49 G52 T55 K56 R59 E63 L67 M1 G2 K3 I4 R5 Q6 F28 K32 S43 K44 I46 N48 R49 G52 T55 K56 R59 E63 L67
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U0U1|RS17E_PYRFU Small ribosomal subunit protein eS17 (Gene Name=rps17e)

[Back to BioLiP]