Structure of PDB 4v4z Chain AS

Receptor sequence
>4v4zAS (length=83) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLK
VDVERARYWLSVGAQPTDTARRLLRQAGVFRQE
3D structure
PDB4v4z Structural basis for messenger RNA movement on the ribosome.
ChainAS
Resolution4.51 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AS M1 R5 L6 F9 G10 S11 K12 H13 H16 Y17 R25 K27 R28 K31 Y32 I33 Y38 R42 K43 T44 W59 V62 G63 Q65 T67 D68 T69 R72 R75 F80 R81 Q82 M1 R5 L6 F9 G10 S11 K12 H13 H16 Y17 R25 K27 R28 K31 Y32 I33 Y38 R42 K43 T44 W59 V62 G63 Q65 T67 D68 T69 R72 R75 F80 R81 Q82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4z, PDBe:4v4z, PDBj:4v4z
PDBsum4v4z
PubMed17051149
UniProtQ5SJH3|RS16_THET8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]