Structure of PDB 4v4p Chain AS

Receptor sequence

>4v4pAS (length=108) Species: 300852 (Thermus thermophilus HB8)

EAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVL
ESAAANAVNNHDLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSH
ITVILGEK

3D structure

• PDB: 4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
• Chain: AS
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	I6 A7 R8 R11 R15 K16 R18 N40 K41 R42 Y45 K49 E52 S53 N57 N61 H62 A74 Y75 V76 D77 E78 G79 R88 R90 I96 K98 R99 H102	I5 A6 R7 R10 R14 K15 R17 N39 K40 R41 Y44 K48 E51 S52 N56 N60 H61 A72 Y73 V74 D75 E76 G77 R86 R88 I94 K96 R97 H100

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v4p, PDBe:4v4p, PDBj:4v4p
• PDBsum: 4v4p
• PubMed: 15802605
• UniProt: Q5SHP3|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)