Structure of PDB 4v4a Chain AS

Receptor sequence

>4v4aAS (length=80) Species: 562 (Escherichia coli)

PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAV
YNGKQHVPVYITENMVGHKLGEFAPTRTYR

3D structure

• PDB: 4v4a X-ray crystal structures of the WT and a hyper-accurate ribosome from Escherichia coli
• Chain: AS
• Resolution: 9.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	P2 S4 L5 K6 K7 F10 H14 K18 T33 W34 R36 R37 Y52 N53 G54 K55 K70 G72 E73 T77 R78 T79 Y80	P1 S3 L4 K5 K6 F9 H13 K17 T32 W33 R35 R36 Y51 N52 G53 K54 K69 G71 E72 T76 R77 T78 Y79

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 04:17:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4a', asym_id = 'AS', title = 'X-ray crystal structures of the WT and a hyper-accurate ribosome from Escherichia coli'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4a', asym_id='AS', title='X-ray crystal structures of the WT and a hyper-accurate ribosome from Escherichia coli')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4v4a', asym_id = 'AS'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='4v4a', asym_id='AS')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>