Structure of PDB 3jbn Chain AS

Receptor sequence

>3jbnAS (length=186) Species: 36329 (Plasmodium falciparum 3D7)

GIALKNVGRIKKHGRKHLVSKNPYLRLLVKLYNFLARRTNANFNKIIAKR
LIMPKRYRPPLSLSKLQYHMANHPNDIAVVVGSITDDKRLFSLKQLKVCA
LRFTETARKRIEDAGGECLTFDQLALKYPTGKKCVLLRGPTKARTAEKHF
GKAPGKPKSKARPYVRSKGRKFEKARGRRKSRAYKK

3D structure

• PDB: 3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.
• Chain: AS
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	G2 L5 K6 N7 V8 G9 R10 I11 K12 K13 G15 R16 H18 S21 R27 K31 F35 R38 R39 N41 N43 K50 M54 P55 K56 R57 Y58 R59 S63 S65 K66 Y69 H70 N73 H74 T86 D87 D88 K89 R90 F92 R103 T105 K133 K134 C135 L137 R139 P141 T142 K143 R145 T146 K149 F151 K153 K157 P158 K159 K161 A162 R163 Y165 R167 S168 K169 R171 K172 K175 R179 R180 S182 R183 A184 Y185 K186 K187	G1 L4 K5 N6 V7 G8 R9 I10 K11 K12 G14 R15 H17 S20 R26 K30 F34 R37 R38 N40 N42 K49 M53 P54 K55 R56 Y57 R58 S62 S64 K65 Y68 H69 N72 H73 T85 D86 D87 K88 R89 F91 R102 T104 K132 K133 C134 L136 R138 P140 T141 K142 R144 T145 K148 F150 K152 K156 P157 K158 K160 A161 R162 Y164 R166 S167 K168 R170 K171 K174 R178 R179 S181 R182 A183 Y184 K185 K186

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
• PDBsum: 3jbn
• PubMed: 26432834
• UniProt: C0H5G3