Structure of PDB 3j9m Chain AS |
>3j9mAS (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] |
AGSRLETVGSIFSRTRDLVRAGVLKEKPLWFDVYDAFPPLREPVFQRPRV RYGKAKAPIQDIWYHEDRIRAKFYSVYGSGQRAFDLFNPNFKSTCQRFVE KYTELQKLGETDEEKLFVETGKALLA |
|
PDB | 3j9m Ribosome. The structure of the human mitochondrial ribosome. |
Chain | AS |
Resolution | 3.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
AS |
R48 Y53 G54 |
R47 Y52 G53 |
|
|
|
|