Structure of PDB 1vy6 Chain AS

Receptor sequence

>1vy6AS (length=83) Species: 300852 (Thermus thermophilus HB8)

PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAV
YNGKQHVPVYITENMVGHKLGEFAPTRTYRGHG

3D structure

• PDB: 1vy6 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.
• Chain: AS
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AS	P2 R3 S4 L5 K6 K7 F10 H14 W34 R36 R37 Y52 N53 G54 K55 K70 G72 E73 T77 R78 T79 Y80 R81 H83	P1 R2 S3 L4 K5 K6 F9 H13 W33 R35 R36 Y51 N52 G53 K54 K69 G71 E72 T76 R77 T78 Y79 R80 H82

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1vy6, PDBe:1vy6, PDBj:1vy6
• PDBsum: 1vy6
• PubMed: 25132179
• UniProt: Q5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)