Structure of PDB 8ewb Chain AR

Receptor sequence

>8ewbAR (length=188) Species: 4932 (Saccharomyces cerevisiae)

ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIV
KKAVTVHSKSRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRV
LRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEHIIQAKADAQR
EKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA

3D structure

• PDB: 8ewb Regulation of translation by ribosomal RNA pseudouridylation.
• Chain: AR
• Resolution: 2.87 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AR	R162 R163 K165 N166 R167 R173 V177 A178 E179 D182 A183	R161 R162 K164 N165 R166 R172 V176 A177 E178 D181 A182
BS02	rna	AR	N3 L4 R5 T6 K8 R9 L10 G18 K19 R20 K21 W23 L24 P26 S37 R38 R42 K46 K53 T56 V57 H58 S59 K60 S61 R62 T63 R64 R71 R74 H75 G77 Y78 G79 R81 K82 G83 T84 R85 E86 A87 R88 L89 P90 Q92 V93 W95 I96 L99 R100 V101 R103 R104 R110 K114 K117 H118 Y120 H121 Y124 K125 K128 G129 H134 K135 R136	N2 L3 R4 T5 K7 R8 L9 G17 K18 R19 K20 W22 L23 P25 S36 R37 R41 K45 K52 T55 V56 H57 S58 K59 S60 R61 T62 R63 R70 R73 H74 G76 Y77 G78 R80 K81 G82 T83 R84 E85 A86 R87 L88 P89 Q91 V92 W94 I95 L98 R99 V100 R102 R103 R109 K113 K116 H117 Y119 H120 Y123 K124 K127 G128 H133 K134 R135

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ewb, PDBe:8ewb, PDBj:8ewb
• PDBsum: 8ewb
• PubMed: 37595043
• UniProt: P0CX82|RL19A_YEAST Large ribosomal subunit protein eL19A (Gene Name=RPL19A)