Structure of PDB 7o0u Chain AR

Receptor sequence
>7o0uAR (length=49) Species: 1379270 (Gemmatimonas phototrophica) [Search protein sequence]
MHRIWMGTDPHIIMSALGSFLVGAVLVMHIWAYGQFNWPATLKAKYATP
3D structure
PDB7o0u 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
ChainAR
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 V7N AR L17 M28 W31 L17 M28 W31
BS02 BCL AR S15 G18 S15 G18
BS03 BCL AR H29 W38 H29 W38
BS04 BCL AR F20 A24 F20 A24
BS05 V7N AR H29 Y33 H29 Y33
BS06 BCL AR V25 M28 H29 F36 V25 M28 H29 F36
BS07 V7N AR M1 R3 M1 R3
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 02:14:45 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7o0u', asym_id = 'AR', title = '2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7o0u', asym_id='AR', title='2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020,0019684,0030077,0045156', uniprot = '', pdbid = '7o0u', asym_id = 'AR'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0030077,0045156', uniprot='', pdbid='7o0u', asym_id='AR')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>