Structure of PDB 4v9q Chain AR

Receptor sequence
>4v9qAR (length=101) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTP
VVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIR
G
3D structure
PDB4v9q Blasticidin S inhibits translation by trapping deformed tRNA on the ribosome.
ChainAR
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AR G8 G9 K10 E23 K24 K68 K69 V72 K74 K76 A77 K78 Q80 Y81 R83 K84 K85 G86 H87 R88 Q89 P90 G8 G9 K10 E23 K24 K68 K69 V72 K74 K76 A77 K78 Q80 Y81 R83 K84 K85 G86 H87 R88 Q89 P90
BS02 MG AR K76 A77 K76 A77
BS03 MG AR K78 V79 Q80 K78 V79 Q80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9q, PDBe:4v9q, PDBj:4v9q
PDBsum4v9q
PubMed23824292
UniProtQ72HR2|RL21_THET2 Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]