Structure of PDB 4v9d Chain AR

Receptor sequence
>4v9dAR (length=55) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
EIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLP
YTDRH
3D structure
PDB4v9d Structures of the bacterial ribosome in classical and hybrid states of tRNA binding.
ChainAR
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AR K37 I38 P40 S41 K49 Q51 R52 A55 R56 K59 R60 R62 Y63 Y69 H73 K19 I20 P22 S23 K31 Q33 R34 A37 R38 K41 R42 R44 Y45 Y51 H55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9d, PDBe:4v9d, PDBj:4v9d
PDBsum4v9d
PubMed21596992
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]