Structure of PDB 4v8u Chain AR

Receptor sequence
>4v8uAR (length=70) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAK
TIKRARILGLLPFTEKLVRK
3D structure
PDB4v8u Crystal structure of 70S ribosome with both cognate tRNAs in the E and P sites representing an authentic elongation complex.
ChainAR
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AR K49 I50 P52 R53 A60 K61 Q63 R64 K68 K71 R72 R74 I75 F81 K31 I32 P34 R35 A42 K43 Q45 R46 K50 K53 R54 R56 I57 F63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v8u, PDBe:4v8u, PDBj:4v8u
PDBsum4v8u
PubMed23527033
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]