Structure of PDB 4v7t Chain AR

Receptor sequence
>4v7tAR (length=55) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
EIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLP
YTDRH
3D structure
PDB4v7t Structures of the Escherichia coli ribosome with antibiotics bound near the peptidyl transferase center explain spectra of drug action.
ChainAR
Resolution3.1942 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AR K37 I38 P40 S41 A48 K49 Q51 R52 R56 K59 R60 R62 Y63 Y69 T70 H73 K19 I20 P22 S23 A30 K31 Q33 R34 R38 K41 R42 R44 Y45 Y51 T52 H55
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7t, PDBe:4v7t, PDBj:4v7t
PDBsum4v7t
PubMed20876128
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]