Structure of PDB 4v6q Chain AR

Receptor sequence
>4v6qAR (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTRLIERLGLRR
3D structure
PDB4v6q Structural characterization of mRNA-tRNA translocation intermediates.
ChainAR
Resolution11.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AR T7 R16 T21 G22 Q27 H41 H45 K47 D48 H49 H50 S51 R53 G54 L56 R57 S60 Q61 K64 L65 Y68 R71 K72 T7 R16 T21 G22 Q27 H41 H45 K47 D48 H49 H50 S51 R53 G54 L56 R57 S60 Q61 K64 L65 Y68 R71 K72
BS02 rna AR Q39 K46 R52 L55 L56 R87 R88 Q39 K46 R52 L55 L56 R87 R88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v6q, PDBe:4v6q, PDBj:4v6q
PDBsum4v6q
PubMed22467828
UniProtQ8X9M2|RS15_ECO57 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]