Structure of PDB 4v6l Chain AR

Receptor sequence

>4v6lAR (length=100) Species: 83333 (Escherichia coli K-12)

AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW

3D structure

• PDB: 4v6l Structural insights into cognate versus near-cognate discrimination during decoding.
• Chain: AR
• Resolution: 13.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AR	A1 K2 Q3 S4 M5 R8 E9 K11 R12 K18 K22 R23 K27 A28 S31 D32 V33 R40 R52 S55 P56 S57 R58 R60 R62 T66 R68 P69 H70 G71 F72 L73 R74 K75 R80 I81 K82 R84 E85 M88 R89 K96 K97 A98 S99 W100	A1 K2 Q3 S4 M5 R8 E9 K11 R12 K18 K22 R23 K27 A28 S31 D32 V33 R40 R52 S55 P56 S57 R58 R60 R62 T66 R68 P69 H70 G71 F72 L73 R74 K75 R80 I81 K82 R84 E85 M88 R89 K96 K97 A98 S99 W100

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6l, PDBe:4v6l, PDBj:4v6l
• PDBsum: 4v6l
• PubMed: 21378755
• UniProt: P0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)