Structure of PDB 8ove Chain AQ

Receptor sequence
>8oveAQ (length=100) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
QRVLVKMTSRNAKAVERVVAELLEHARTEKVEVRGPVRLPTRRLRITTRK
TPCGNGTNTWDTFEMKIYKRLVDLRASTELVKKITSFQIEAGVDVSITIP
3D structure
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainAQ
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AQ Q15 K20 R52 P54 T55 R63 T65 P66 C67 G68 N69 G70 T71 T73 K83 R84 R89 Q1 K6 R38 P40 T41 R49 T51 P52 C53 G54 N55 G56 T57 T59 K69 R70 R75
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Apr 17 13:59:41 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ove', asym_id = 'AQ', title = 'A single pseudouridine on rRNA regulates ribosom...ion in the mammalian parasite Trypanosoma brucei.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ove', asym_id='AQ', title='A single pseudouridine on rRNA regulates ribosom...ion in the mammalian parasite Trypanosoma brucei.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0015935', uniprot = '', pdbid = '8ove', asym_id = 'AQ'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015935', uniprot='', pdbid='8ove', asym_id='AQ')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>