Structure of PDB 8ova Chain AQ

Receptor sequence

>8ovaAQ (length=100) Species: 5702 (Trypanosoma brucei brucei)

QRVLVKMTSRNAKAVERVVAELLEHARTEKVEVRGPVRLPTRRLRITTRK
TPCGNGTNTWDTFEMKIYKRLVDLRASTELVKKITSFQIEAGVDVSITIP

3D structure

• PDB: 8ova A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
• Chain: AQ
• Resolution: 2.47 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AQ	Q15 G49 V51 R52 P54 T55 R56 R57 R63 P66 C67 G68 N69 G70 T71 T73 W74 Y82 R84	Q1 G35 V37 R38 P40 T41 R42 R43 R49 P52 C53 G54 N55 G56 T57 T59 W60 Y68 R70

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Dec 3 06:55:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8ova', asym_id = 'AQ', title = 'A single pseudouridine on rRNA regulates ribosom...ion in the mammalian parasite Trypanosoma brucei.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8ova', asym_id='AQ', title='A single pseudouridine on rRNA regulates ribosom...ion in the mammalian parasite Trypanosoma brucei.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0015935', uniprot = '', pdbid = '8ova', asym_id = 'AQ'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0015935', uniprot='', pdbid='8ova', asym_id='AQ')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>