Structure of PDB 8fmw Chain AQ

Receptor sequence

>8fmwAQ (length=119) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence]

MKKIKEAEQRKLRRKKRIKDKIGRGVASRPRITVFKSNRYFYAQVIDDSK
GHTIASISTIEKSLNLGKNIDDVKKLGEVLAKRLKEKNINNLIFDRNGYK
YHGLIASFATSLREFGINI

3D structure

PDB

8fmw The structure of a hibernating ribosome in a Lyme disease pathogen.

Chain

Resolution

2.86 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AQ	K2 K3 R10 R13 R14 K16 R17 D20 I22 F94 R96 Y101 R113 I119	K2 K3 R10 R13 R14 K16 R17 D20 I22 F94 R96 Y101 R113 I119
BS02	rna	AQ	K19 R31 F35 K36 S37 N38 R39 Y40 Y42 Q44 G51 H52 T53 S56 K62 N69 I70 H102 L104	K19 R31 F35 K36 S37 N38 R39 Y40 Y42 Q44 G51 H52 T53 S56 K62 N69 I70 H102 L104

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8fmw, PDBe:8fmw, PDBj:8fmw
PDBsum	8fmw
PubMed	37907464
UniProt	O51447\|RL18_BORBU Large ribosomal subunit protein uL18 (Gene Name=rplR)