Structure of PDB 7q0p Chain AQ

Receptor sequence
>7q0pAQ (length=91) Species: 237561 (Candida albicans SC5314) [Search protein sequence]
TKRTKKVGITGKFGVRYGSSLRRQTKKLEVQQHAKYDCSFCGKRTVQRGA
TGIWNCKSCKKTVAGGAYTVSTAAAATVRSTIRRLRELAEA
3D structure
PDB7q0p E-site drug specificity of the human pathogen Candida albicans ribosome.
ChainAQ
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AQ T2 R4 T5 K6 K7 V8 G9 I10 G12 K13 F14 G15 V16 R17 Y18 G19 S20 S21 R23 H34 F41 C42 K44 R49 A51 T52 K58 T1 R3 T4 K5 K6 V7 G8 I9 G11 K12 F13 G14 V15 R16 Y17 G18 S19 S20 R22 H33 F40 C41 K43 R48 A50 T51 K57
BS02 ZN AQ C39 C42 C57 C60 C38 C41 C56 C59
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q0p, PDBe:7q0p, PDBj:7q0p
PDBsum7q0p
PubMed35613268
UniProtA0A1D8PP14|RL43A_CANAL Large ribosomal subunit protein eL43 (Gene Name=RPL43A)

[Back to BioLiP]