Structure of PDB 7o0u Chain AQ

Receptor sequence
>7o0uAQ (length=49) Species: 1379270 (Gemmatimonas phototrophica) [Search protein sequence]
MHRIWMGTDPHIIMSALGSFLVGAVLVMHIWAYGQFNWPATLKAKYATP
3D structure
PDB7o0u 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
ChainAQ
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL AQ M14 S15 G18 M14 S15 G18
BS02 BCL AQ V25 H29 W38 V25 H29 W38
BS03 V7N AQ M1 R3 M1 R3
BS04 0V9 AQ D9 H11 S15 D9 H11 S15
BS05 BCL AQ W5 I13 F20 W5 I13 F20
BS06 V7N AQ P10 M14 L17 W31 P10 M14 L17 W31
BS07 BCL AQ M28 H29 W31 F36 M28 H29 W31 F36
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 02:37:16 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7o0u', asym_id = 'AQ', title = '2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7o0u', asym_id='AQ', title='2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020,0019684,0030077,0045156', uniprot = '', pdbid = '7o0u', asym_id = 'AQ'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0030077,0045156', uniprot='', pdbid='7o0u', asym_id='AQ')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>