Structure of PDB 6vmi Chain AQ

Receptor sequence
>6vmiAQ (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
AKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRR
RQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
3D structure
PDB6vmi Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
ChainAQ
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AQ A2 K3 H4 R42 P48 C49 R52 Q53 Y57 R62 Y64 N65 M68 R80 A81 D82 A1 K2 H3 R41 P47 C48 R51 Q52 Y56 R61 Y63 N64 M67 R79 A80 D81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6vmi, PDBe:6vmi, PDBj:6vmi
PDBsum6vmi
PubMed32737313
UniProtP82921|RT21_HUMAN Small ribosomal subunit protein bS21m (Gene Name=MRPS21)

[Back to BioLiP]