Structure of PDB 6nu3 Chain AQ

Receptor sequence
>6nu3AQ (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
AKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCCR
RQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
3D structure
PDB6nu3 Structural insights into unique features of the human mitochondrial ribosome recycling.
ChainAQ
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AQ A2 K3 H4 K6 F7 D33 G34 D38 Y45 P48 C49 R52 Q53 Y57 R59 Y64 N65 C87 A1 K2 H3 K5 F6 D32 G33 D37 Y44 P47 C48 R51 Q52 Y56 R58 Y63 N64 C86
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nu3, PDBe:6nu3, PDBj:6nu3
PDBsum6nu3
PubMed30962385
UniProtP82921|RT21_HUMAN Small ribosomal subunit protein bS21m (Gene Name=MRPS21)

[Back to BioLiP]