Structure of PDB 6nu2 Chain AQ

Receptor sequence
>6nu2AQ (length=86) Species: 9606 (Homo sapiens) [Search protein sequence]
AKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCCR
RQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC
3D structure
PDB6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.
ChainAQ
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AQ K3 K6 D33 P48 C49 R52 Q53 Y57 R59 C60 R62 Y64 N65 M66 A81 K2 K5 D32 P47 C48 R51 Q52 Y56 R58 C59 R61 Y63 N64 M65 A80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
PDBsum6nu2
PubMed30962385
UniProtP82921|RT21_HUMAN Small ribosomal subunit protein bS21m (Gene Name=MRPS21)

[Back to BioLiP]