Structure of PDB 5ngm Chain AQ

Receptor sequence

>5ngmAQ (length=112) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

MEAKAVARTIRIAPRKVRLVLDLIRGKNAAEAIAILKLTNKASSPVIEKV
LMSALANAEHNYDMNTDELVVKEAYANEGPTLKRFRPRAQGRASAINKRT
SHITIVVSDGKE

3D structure

PDB

5ngm The cryo-EM structure of hibernating 100S ribosome dimer from pathogenic Staphylococcus aureus.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AQ	K4 A5 V6 R8 R11 R15 K16 R18 R25 N40 K41 A42 S53 A56 N57 H60 N61 Y62 N77 E78 P80 K83 R86 P87 R88 Q90 G91 R92 A93 A95 I96 N97 R99 H102	K4 A5 V6 R8 R11 R15 K16 R18 R25 N40 K41 A42 S53 A56 N57 H60 N61 Y62 N77 E78 P80 K83 R86 P87 R88 Q90 G91 R92 A93 A95 I96 N97 R99 H102

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links