Structure of PDB 4v8k Chain AQ

Receptor sequence
>4v8kAQ (length=57) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]
NANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIPVS
YQALGKK
3D structure
PDB4v8k Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom
ChainAQ
Resolution3.006 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CRT AQ L33 H36 M37 L29 H32 M33
BS02 CA AQ N45 W46 L47 D49 N50 N41 W42 L43 D45 N46
BS03 BCL AQ Q28 H36 W46 Q24 H32 W42
BS04 BCL AQ Q28 L31 G32 I35 H36 Q24 L27 G28 I31 H32
BS05 CRT AQ I24 F27 Q28 L31 I35 I20 F23 Q24 L27 I31
BS06 CRT AQ K10 I11 I14 K6 I7 I10
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8k, PDBe:4v8k, PDBj:4v8k
PDBsum4v8k
PubMed24670637
UniProtD2Z0P2

[Back to BioLiP]