Structure of PDB 4v8d Chain AQ

Receptor sequence
>4v8dAQ (length=58) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQL
PGVRKASW
3D structure
PDB4v8d A new understanding of the decoding principle on the ribosome.
ChainAQ
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AQ K4 A5 L6 E8 K9 R12 K15 F16 K17 V18 R19 Y21 R29 R31 S32 Y34 R35 R41 I42 R45 E46 K58 S60 W61 K1 A2 L3 E5 K6 R9 K12 F13 K14 V15 R16 Y18 R26 R28 S29 Y31 R32 R38 I39 R42 E43 K55 S57 W58
BS02 ZN AQ C24 C27 G28 R29 C21 C24 G25 R26
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Nov 26 23:58:52 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v8d', asym_id = 'AQ', title = 'A new understanding of the decoding principle on the ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v8d', asym_id='AQ', title='A new understanding of the decoding principle on the ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v8d', asym_id = 'AQ'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v8d', asym_id='AQ')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>