Structure of PDB 4v7h Chain AQ

Receptor sequence

>4v7hAQ (length=80) Species: 5541 (Thermomyces lanuginosus)

RGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFR
VQVGDIVTVGQCRPISKTVRFNVVKVSAAA

3D structure

• PDB: 4v7h Comprehensive molecular structure of the eukaryotic ribosome.
• Chain: AQ
• Resolution: 8.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AQ	R67 G68 K69 S77 K79 M80 H81 R82 T83 R87 Y90 L91 H92 Y93 K96 R99 K102 R103 H104 K105 N106 V107 C128 R129 P130 K133 T134 R136 F137	R1 G2 K3 S11 K13 M14 H15 R16 T17 R21 Y24 L25 H26 Y27 K30 R33 K36 R37 H38 K39 N40 V41 C62 R63 P64 K67 T68 R70 F71

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Feb 18 20:28:53 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7h', asym_id = 'AQ', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7h', asym_id='AQ', title='Comprehensive molecular structure of the eukaryotic ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v7h', asym_id = 'AQ'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v7h', asym_id='AQ')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>