Structure of PDB 4v6o Chain AQ

Receptor sequence

>4v6oAQ (length=100) Species: 562 (Escherichia coli)

AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW

3D structure

• PDB: 4v6o Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: AQ
• Resolution: 14.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AQ	A1 K2 Q3 S4 M5 R8 E9 R12 A16 D17 Y19 F20 A21 E25 K27 D32 V33 N34 Q48 T49 P51 R52 S55 P56 S57 R58 R60 N61 R62 G67 R68 P69 H70 G71 F72 L73 R74 K75 R80 I81 K82 R84 K97 S99 W100	A1 K2 Q3 S4 M5 R8 E9 R12 A16 D17 Y19 F20 A21 E25 K27 D32 V33 N34 Q48 T49 P51 R52 S55 P56 S57 R58 R60 N61 R62 G67 R68 P69 H70 G71 F72 L73 R74 K75 R80 I81 K82 R84 K97 S99 W100

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
• PDBsum: 4v6o
• PubMed: 22467828
• UniProt: P0AG59|RS14_ECOLI Small ribosomal subunit protein uS14 (Gene Name=rpsN)