Structure of PDB 3jbp Chain AQ

Receptor sequence

>3jbpAQ (length=189) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

GRRPARCYRYCKNKPYPKSRYCRGVPDPKIRIYDMGRKKADVNEFSGVVH
LVSYEYEQISSEALEAARISANKYMITNCGKDNFHLRVRIHPFHVLRINK
AFGKPNGVVARVDIGQVLLSIRTKENFVSKACEALRRAKYKFPGRQKVFV
SNKWGFTPFSKDEYQQYKKKGRIISDGVSCKFIREKGPL

3D structure

PDB

3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

6.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AQ	R3 R4 R7 K13 N14 K15 K19 R21 Y22 R24 R32 K39 S61 A64 A67 K74 R88 R90 H92 F94 R98 F119 Q133 R154 Y157 K158 P160 R162 D193 G194	R2 R3 R6 K12 N13 K14 K18 R20 Y21 R23 R31 K38 S60 A63 A66 K73 R87 R89 H91 F93 R97 F102 Q116 R137 Y140 K141 P143 R145 D176 G177
BS02	rna	AQ	R10 Y11 E56 R201 E202 K203 G204 P205	R9 Y10 E55 R184 E185 K186 G187 P188

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbp, PDBe:3jbp, PDBj:3jbp
PDBsum	3jbp
PubMed	26432834
UniProt	Q8ILV2

[Back to BioLiP]