Structure of PDB 8jdl Chain AP

Receptor sequence
>8jdlAP (length=45) Species: 9606 (Homo sapiens) [Search protein sequence]
RKFGQGSRSCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFIKLD
3D structure
PDB8jdl Glycosylated queuosines in tRNAs optimize translational rate and post-embryonic growth.
ChainAP
Resolution2.42 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AP R12 K13 F14 Q16 G17 R19 C24 N26 H28 G29 L30 I31 R32 K33 Y34 R40 Q41 C42 R44 K54 L55 D56 R1 K2 F3 Q5 G6 R8 C13 N15 H17 G18 L19 I20 R21 K22 Y23 R29 Q30 C31 R33 K43 L44 D45
BS02 ZN AP C21 C39 C10 C28
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0070062 extracellular exosome
GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8jdl, PDBe:8jdl, PDBj:8jdl
PDBsum8jdl
PubMed37992713
UniProtP62273|RS29_HUMAN Small ribosomal subunit protein uS14 (Gene Name=RPS29)

[Back to BioLiP]