Structure of PDB 8cre Chain AP

Receptor sequence

>8creAP (length=103) Species: 5476 (Candida albicans) [Search protein sequence]

VNVPKTRKTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYG
GQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLPLKRCKHFELGGDKKQKG
QAL

3D structure

PDB

8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement

Chain

Resolution

3.0 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AP	V2 N3 P5 R8 K9 T10 Y11 K13 K15 R18 K19 H20 Y28 A30 G31 K32 A33 S34 F36 A37 Q38 G39 R41 R45 K46 G49 Y50 G51 G52 Q53 Q56 I57 F58 K60 A62 K63 T65 K66 K67 T79 K80 Q82 K86 R87 C88 K89 K97 K98 K100	V1 N2 P4 R7 K8 T9 Y10 K12 K14 R17 K18 H19 Y27 A29 G30 K31 A32 S33 F35 A36 Q37 G38 R40 R44 K45 G48 Y49 G50 G51 Q52 Q55 I56 F57 K59 A61 K62 T64 K65 K66 T78 K79 Q81 K85 R86 C87 K88 K96 K97 K99
BS02	3K5	AP	K40 Y43 I57 F58	K39 Y42 I56 F57
BS03	ZN	AP	C17 C74 C77	C16 C73 C76
BS04	MG	AP	C12 H23	C11 H22

External links