Structure of PDB 7q08 Chain AP

Receptor sequence

>7q08AP (length=103) Species: 237561 (Candida albicans SC5314)

VNVPKTRKTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYG
GQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLPLKRCKHFELGGDKKQKG
QAL

3D structure

• PDB: 7q08 E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: AP
• Resolution: 2.56 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AP	V2 N3 P5 R8 K9 Y11 K13 R18 H20 Y28 G31 S34 F36 A37 Q38 G39 R41 R42 R45 K46 G49 Y50 G52 Q53 T54 X55 Q56 I57 F58 K60 K61 A62 K63 T65 K67 V69 K80 Q82 K86 C88 K89 K97 K98 K100	V1 N2 P4 R7 K8 Y10 K12 R17 H19 Y27 G30 S33 F35 A36 Q37 G38 R40 R41 R44 K45 G48 Y49 G51 Q52 T53 X54 Q55 I56 F57 K59 K60 A61 K62 T64 K66 V68 K79 Q81 K85 C87 K88 K96 K97 K99
BS02	ZN	AP	C12 C17 C74 C77	C11 C16 C73 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q08, PDBe:7q08, PDBj:7q08
• PDBsum: 7q08
• PubMed: 35613268
• UniProt: A0A1D8PEV4|RL44_CANAL Large ribosomal subunit protein eL42 (Gene Name=RPL44)