Structure of PDB 6zs9 Chain AP

Receptor sequence
>6zs9AP (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
NEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHI
TGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYR
3D structure
PDB6zs9 Structural basis of mitochondrial translation.
ChainAP
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AP C90 R94 H95 Q104 K105 K109 K112 R113 I116 V122 C44 R48 H49 Q58 K59 K63 K66 R67 I70 V76
BS02 ZN AP C68 K102 C22 K56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zs9, PDBe:6zs9, PDBj:6zs9
PDBsum6zs9
PubMed32812867
UniProtQ9Y3D5|RT18C_HUMAN Small ribosomal subunit protein bS18m (Gene Name=MRPS18C)

[Back to BioLiP]