Structure of PDB 6vlz Chain AP

Receptor sequence
>6vlzAP (length=96) Species: 9606 (Homo sapiens) [Search protein sequence]
NEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHI
TGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE
3D structure
PDB6vlz Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
ChainAP
Resolution2.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AP C90 I91 G93 R94 H95 K102 K105 K109 K112 R113 I116 C44 I45 G47 R48 H49 K56 K59 K63 K66 R67 I70
BS02 ZN AP C65 I66 L67 C68 C19 I20 L21 C22
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6vlz, PDBe:6vlz, PDBj:6vlz
PDBsum6vlz
PubMed32737313
UniProtQ9Y3D5|RT18C_HUMAN Small ribosomal subunit protein bS18m (Gene Name=MRPS18C)

[Back to BioLiP]